Protein Info for Ac3H11_103 in Acidovorax sp. GW101-3H11

Annotation: Benzoate transport, inner-membrane translocator precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 137 to 155 (19 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 234 to 253 (20 residues), see Phobius details amino acids 272 to 297 (26 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 57 to 320 (264 residues), 122.4 bits, see alignment E=1e-39

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 61% identity to dsh:Dshi_3726)

Predicted SEED Role

"Benzoate transport, inner-membrane translocator precursor" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165I096 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Ac3H11_103 Benzoate transport, inner-membrane translocator precursor (Acidovorax sp. GW101-3H11)
MSTPASSSTIGPRGGAVAMASSERPRRSAATWLAILFFAGALLFGGIALALGDVFYLRLA
TEALIFGGLALSVDLLLGRVGLLPLGQALFFGLGAYVSALVLKNWSDSFWLALGVTLAFS
AVAGLIGGLIAIRAKGVYFALISFGLAQVLSKVVYNTRELGASDGIIGVPSANIMWGVNS
ATPSGFFLVVLAFIGVLYLVLRYLMDTPVGRQLDAIRTNEHRVSFLGEDPWRYKLGAFVA
AACIAGCSGALYPMLRGFVSPELMFFQVSGNAVINVIVGGTGTLIGPLYGSAILTGLRSV
VGSFTTHHHIVIGVLFVLVVILMPRGLIGYATPALQRWLDARRNQKENR