Protein Info for Ac3H11_1009 in Acidovorax sp. GW101-3H11

Annotation: Death on curing protein, Doc toxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF02661: Fic" amino acids 5 to 89 (85 residues), 62.5 bits, see alignment E=2.9e-21 TIGR01550: death-on-curing family protein" amino acids 6 to 125 (120 residues), 49 bits, see alignment E=3.3e-17

Best Hits

KEGG orthology group: K07341, death on curing protein (inferred from 83% identity to vei:Veis_2466)

Predicted SEED Role

"Death on curing protein, Doc toxin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A165JUC1 at UniProt or InterPro

Protein Sequence (131 amino acids)

>Ac3H11_1009 Death on curing protein, Doc toxin (Acidovorax sp. GW101-3H11)
MSWRWISKQALVLLHGESLATHGGREGMRDEGLLESALMRPQNIMAYADADNPPDAAALA
ASYGVGLAKNHPFVDGNKRAAFLAVGLFLYLNGLRLQATQTDATLTMLAVAAGDITEEAF
AAWLREHAVAR