Protein Info for AZOBR_RS33800 in Azospirillum brasilense Sp245

Annotation: putative Membrane protein-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 161 to 187 (27 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 231 to 258 (28 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 357 to 374 (18 residues), see Phobius details amino acids 382 to 404 (23 residues), see Phobius details amino acids 419 to 438 (20 residues), see Phobius details amino acids 450 to 474 (25 residues), see Phobius details PF09913: DUF2142" amino acids 29 to 422 (394 residues), 122.4 bits, see alignment E=1.1e-39

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8B1G2 at UniProt or InterPro

Protein Sequence (478 amino acids)

>AZOBR_RS33800 putative Membrane protein-like protein (Azospirillum brasilense Sp245)
MSRSVPVRLRAAFRFEPLLIAVPSILFFLLFGAFLLVKTPPYAGPDEPFHWQRVLQIAQG
RFLADTLGPNSWGGPIDEAGYLHMIHYFVLIQKHEPVDAAQARALSDHLAGKPPADRVVP
FPSSASFAPLAYMPQAAFVAAARAWGLGPLEQAHAGRIGNFAVYGLMILAILRALPGGRL
VFLALALSPGALQSACSLSADPLNLMLPALMLALVWGYRERGAPLGPWDMAGLVALSAAL
GLLKLTMAPFAGVVLYLPAAVAGGSTRFRIGLAALCLGVALGIALLWNMAYPFVPGPYWG
TGADPAAQLARLRADPLGTLELFAVNAWEWGLTWWRDSYGRYGGHPSPWSGYAPDRWILP
ALFVLPLLALCDGARRRDPVVAVGYLLPAPGYVLLIMTAFWIGYTTVGSTTVEGVQGRYF
LAAQLLVVLALAAAAGPWTPAGLRRGLRLGLFAAALALSGAVLVHVLTAWSALWVPAG