Protein Info for AZOBR_RS33775 in Azospirillum brasilense Sp245

Annotation: sulfate adenylyltransferase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 TIGR02039: sulfate adenylyltransferase, small subunit" amino acids 8 to 301 (294 residues), 510.3 bits, see alignment E=9.5e-158 PF01507: PAPS_reduct" amino acids 29 to 255 (227 residues), 190.5 bits, see alignment E=1.3e-60

Best Hits

Swiss-Prot: 90% identical to NODP_AZOBR: Sulfate adenylyltransferase subunit 2 (nodP) from Azospirillum brasilense

KEGG orthology group: K00957, sulfate adenylyltransferase subunit 2 [EC: 2.7.7.4] (inferred from 74% identity to bid:Bind_0071)

MetaCyc: 64% identical to sulfate adenylyltransferase subunit 2 (Escherichia coli K-12 substr. MG1655)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8B1F7 at UniProt or InterPro

Protein Sequence (301 amino acids)

>AZOBR_RS33775 sulfate adenylyltransferase subunit 2 (Azospirillum brasilense Sp245)
MPTLPDDLRLLEAESIAILREVAAAFTRPVMLYSIGKDSGVLLHLARKAFHPSPIPFPLL
HVDTGWKFREMIAFRDETVRRLGLRLLVHRNEDGVARGIDPIRSGSALHTRVMKTEALRQ
ALDRHGFDAAIGGARRDEEKSRAKERVFSVRSAAHSWDPRDQRPEPWRLWNTRLAPGESV
RVFPLSNWTEMDVWRYVAAERLPVVPLYFAAERPMVRRSGALIMVDDGRLPLNPGEVPEI
MRVRFRTLGCYPLSGAIPSDAATVEDILAEMRASRTSERQGRLIDGDEPASMERKKREGY
F