Protein Info for AZOBR_RS33440 in Azospirillum brasilense Sp245

Annotation: secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 42 to 62 (21 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 37 to 451 (415 residues), 334.4 bits, see alignment E=5.5e-104 PF13533: Biotin_lipoyl_2" amino acids 88 to 126 (39 residues), 35.1 bits, see alignment 1.4e-12 PF13437: HlyD_3" amino acids 299 to 391 (93 residues), 41.3 bits, see alignment E=3.4e-14 PF00529: CusB_dom_1" amino acids 348 to 390 (43 residues), 26.7 bits, see alignment 6.6e-10

Best Hits

KEGG orthology group: None (inferred from 48% identity to azl:AZL_f01580)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8B187 at UniProt or InterPro

Protein Sequence (452 amino acids)

>AZOBR_RS33440 secretion protein (Azospirillum brasilense Sp245)
MTALLLRRPQTLDRAAEQAINDFQGETAEITGQPEPSTARSVVWTLAVMVVLFIILASVT
TLDRVVTASGRIISQEPTIVVQPLEISLIRSLNVRAGQTVRQGDVLATLDATFSAADVAQ
LERQVAKLSAEIERMNAEAANTPYTVAGKDPDKLLQESIWRYRQAEYAAKLANFDQRMAT
LQATIKNNQTDAEHYRSRLKIVGEIETMRRTLEKNQTGSRLNSLIASDTRVETERNLSNS
ESTIRTASHELEALRAEREVYIQQWRSTLLTDLSTRQVDLERAREELSKAQKRRDLVELR
AVEDAVVLEVGKYSVGSVVEQAQPIYTLVPLRSKLEVEVEIAGMDQGFVKPGDEVQVKFE
AYRYVKHGMAKGVVRTISEDSFTKREDQSQVARPFYRARIELTDVKLRDVPADFRLVPGM
PLTADIVVGERTIISYLVEGALKNSLEGMREP