Protein Info for AZOBR_RS32320 in Azospirillum brasilense Sp245

Annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF00356: LacI" amino acids 3 to 46 (44 residues), 59.9 bits, see alignment 3.3e-20 PF00532: Peripla_BP_1" amino acids 58 to 308 (251 residues), 100.7 bits, see alignment E=2.1e-32 PF13407: Peripla_BP_4" amino acids 60 to 273 (214 residues), 42.4 bits, see alignment E=1.3e-14 PF13377: Peripla_BP_3" amino acids 165 to 326 (162 residues), 129.9 bits, see alignment E=2.1e-41

Best Hits

KEGG orthology group: K03435, LacI family transcriptional regulator, fructose operon transcriptional repressor (inferred from 77% identity to azl:AZL_c02640)

Predicted SEED Role

"Fructose repressor FruR, LacI family" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8B0J0 at UniProt or InterPro

Protein Sequence (330 amino acids)

>AZOBR_RS32320 LacI family transcriptional regulator (Azospirillum brasilense Sp245)
IGIKDVAREAGVSVATVSRVLSNGPVSDALRARVEDAVRTTGYRPNLSARRLRSQHSQTI
GLIVSDIRNPFFTAVSRAVEDAAFQAGMRVILCNTDENPEREAMYLRLMQEERVTGLIFA
PTRATLAQLDRADLDFPVVLIDRSAPAGRFDSVVLDNPQAAALLVDHLHGQGYRRIAGLF
GNTSTTAVERHAGYQAALAAHGLHAEARFVPPTAEAAETEIARWLAEAWRSGAMPDAVMV
SNSLLLMGVVKATRTLGLAIPGDLAVAGFDNEAWTELVGPGLTVIEQPVHEIGRAAMTLL
FERLDDPERATRKVVLSGTCVARGSTGEVG