Protein Info for AZOBR_RS31885 in Azospirillum brasilense Sp245

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 62 to 81 (20 residues), see Phobius details amino acids 91 to 136 (46 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 196 to 213 (18 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 282 to 310 (29 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 59 to 335 (277 residues), 127.4 bits, see alignment E=2.9e-41

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 93% identity to azl:AZL_a03950)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8B093 at UniProt or InterPro

Protein Sequence (349 amino acids)

>AZOBR_RS31885 ABC transporter permease (Azospirillum brasilense Sp245)
MRLEPREHTPLAARLLAPVAAVVAALALCALLVAWTGAPVLRAYGLLLEGAAGSRFALTE
TLTRATPLILTGLAAAVAFRAKLWNIGAEGQLYMGALAAVVLGGGMLDLPAWLLLPTVMI
AGAAAGGATLLGPAVLKVRFGVDEVVTTLLLNFIVLLLVSMLLEGALKDPMGMGWPQSAP
VVEAAELPKLVERTRLHTGLLVALGLSALLWLIDTRTIWGYENRAVGANPRAAAFAGMPV
TRVMLRTALLSGGLAGLAGVIEVCGLKGYLTLDLSPGFGYSGIVVAMLAQLHPVGVVGAA
VFIAGIFVGADAMSRAMPVPNYIADVLVATSLLCMLVAGLLTRYRLRRG