Protein Info for AZOBR_RS31395 in Azospirillum brasilense Sp245

Annotation: cupin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07883: Cupin_2
  • amino acids 36 to 102 (67 residues), 50 bits, E=1.9e-17
• PF02311: AraC_binding
  • amino acids 46 to 92 (47 residues), 22.3 bits, E=9.6e-09

Best Hits

Swiss-Prot: 51% identical to KDGF_DICD3: Pectin degradation protein KdgF (kdgF) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 80% identity to azl:AZL_d01430)

MetaCyc: 45% identical to unsaturated pyranuronate lyase monomer (Yersinia enterocolitica)
RXN-12877 [EC: 4.2.99.25]; 4.2.99.25 [EC: 4.2.99.25]

Predicted SEED Role

"Pectin degradation protein KdgF" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

MetaCyc Pathways

• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
• alginate degradation (2/7 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (16/31 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.25

Sequence Analysis Tools

See G8AZX7 at UniProt or InterPro

Protein Sequence (111 amino acids)

>AZOBR_RS31395 cupin (Azospirillum brasilense Sp245)
MSTDVFVIDEAVDWQDLGAGVRRKILGHNDAMMMVRVEFETGAIGPQHRHPHVQCAVVEK
GAFDVTIEGVTRRLGTGDGYMVPSNALHGVVALEPGVLLDIFTPPREDFLA