Protein Info for AZOBR_RS30970 in Azospirillum brasilense Sp245

Annotation: glycine oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01266: DAO" amino acids 1 to 348 (348 residues), 256.1 bits, see alignment E=1.4e-79 TIGR02352: glycine oxidase ThiO" amino acids 1 to 352 (352 residues), 365.8 bits, see alignment E=1.1e-113 PF00890: FAD_binding_2" amino acids 2 to 256 (255 residues), 33.1 bits, see alignment E=7.4e-12 PF13450: NAD_binding_8" amino acids 3 to 42 (40 residues), 26 bits, see alignment 1.9e-09

Best Hits

KEGG orthology group: K03153, glycine oxidase [EC: 1.4.3.19] (inferred from 82% identity to azl:AZL_004520)

Predicted SEED Role

"Glycine oxidase ThiO (EC 1.4.3.19)" in subsystem Thiamin biosynthesis (EC 1.4.3.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AZN3 at UniProt or InterPro

Protein Sequence (374 amino acids)

>AZOBR_RS30970 glycine oxidase (Azospirillum brasilense Sp245)
IAVIGAGVIGLSIAWRLAAAGCRVEVFDRGAAGRGASHAAGGMLAACVETEPGEESLLPL
TRASQDLWPAFAAELEAASGMAVDLRGEGTMVIALNADDAAKVRFLHDFQTRLGLPVEWL
SGAEVRRREPYLQPGVAGALFCAGDHQVDNRKVATALHAAALRAGAVVHEYAEVSRIEVR
GGRAVGIQVEDRLVEADQVVLAAGAWSGWIDGLSPAVRPPVRPVKGQMLCLRMDARLPLL
RHVVWTPGTYLIPRLDGRLLVGATTEERGFDDRLTAGGQFALLEGAWRALPGIAELPIEE
AWAGFRPGTRDDAPILGLSEVEGLVYATGHHRNGILLTPVTADSVARLVLTGEADPVIRP
FALDRFAQPKGAAA