Protein Info for AZOBR_RS30860 in Azospirillum brasilense Sp245

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 763 PF08446: PAS_2" amino acids 11 to 123 (113 residues), 47.2 bits, see alignment E=8.4e-16 PF01590: GAF" amino acids 155 to 314 (160 residues), 43.1 bits, see alignment E=1.5e-14 PF00360: PHY" amino acids 333 to 515 (183 residues), 202.8 bits, see alignment E=7.7e-64 PF00512: HisKA" amino acids 533 to 597 (65 residues), 45 bits, see alignment E=2.3e-15 PF02518: HATPase_c" amino acids 640 to 751 (112 residues), 73.7 bits, see alignment E=4e-24

Best Hits

KEGG orthology group: None (inferred from 58% identity to mrd:Mrad2831_4270)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AZK3 at UniProt or InterPro

Protein Sequence (763 amino acids)

>AZOBR_RS30860 sensor histidine kinase (Azospirillum brasilense Sp245)
MTVGDLDLDACSREPIHRPGSIQPHGMLLAFSGSDAGAPLIQASANAALALSLPLEQALG
LPLERALHPQIAAAARSFLAAGPVPSRPVPVVLTELPGAGRHQLLAHAVDDAAGNRVVIL
ELERLDGLETDLLDHVYPRMREALERLDALNAPTDLLSCAAQEVRALTGFDRVLIYRFDA
DWHGTVVAEDGNGRLPSYMDLRFPASDIPTQARELYRLNRQRLIPDAGYAPVPLVALPPA
LEGALPLDLSFSVLRSVSPVHVQYMRNMETASSMSVSVLLHGALWGLVSCHHHEPKAVSY
AVRSACDLIAQILSVRIAAVEDRRDAEHRIALQAIQARLLAAMAQADPFITGLTEHPDDL
LRFANASGAAVVFERRCTLVGDTPTEEQVRGLVDWLATQGEPEQFETDSLPALYPAAADF
EGKAAGLLAVAVSKLHASYVLWFRPEVVRTVRWGGDPRKPLGREGQGQGQGLSPRTSFET
WKETVRHRALPWTAAERDTAAALRHAVIGIVLRKAEELASLSRELARSNKELESFSYSVS
HDLRAPFRHIVGYAELLQELEADQLSETGKRYLDVIVDAANSAGTLVDNLLHFSQMGRSE
LTPVSMDMNALVAEVRETLAPDTAGRAIEWDIAPLPTVRGDPVMMRLVLQNLLSNAIKYS
RGREPARIAVGCEDRPTETIFFVRDNGVGFNQAYEKKLFGVFQRLHRNEEFEGIGIGLAN
VRRAVDRHGGRTWADGRLDKGAIFYFTLPKAGTAKPDLRDLDE