Protein Info for AZOBR_RS30625 in Azospirillum brasilense Sp245

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 164 to 168 (5 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details amino acids 313 to 339 (27 residues), see Phobius details amino acids 346 to 366 (21 residues), see Phobius details amino acids 378 to 397 (20 residues), see Phobius details PF07690: MFS_1" amino acids 21 to 362 (342 residues), 106.2 bits, see alignment E=1.8e-34 amino acids 252 to 403 (152 residues), 40.6 bits, see alignment E=1.6e-14 PF12832: MFS_1_like" amino acids 176 to 374 (199 residues), 25.5 bits, see alignment E=6.7e-10

Best Hits

KEGG orthology group: None (inferred from 75% identity to azl:AZL_020020)

Predicted SEED Role

"major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AZF0 at UniProt or InterPro

Protein Sequence (411 amino acids)

>AZOBR_RS30625 MFS transporter (Azospirillum brasilense Sp245)
VGGAPSPRSWRTPGFVVACGCLIAMLAFGPRSSMGLFTAPLSEAHGWGRDVFALSIAIQN
LVWGIGTPFAGALCDRYGPALVLGISGVLYALGLALMPYADTPLMLHLSSGLLIGLGLAG
ASFGIVIAGFSRIVPPEKRSWSMGVATAAGSMGQFLFAPTGQAFIAAYGWQTALILFGAS
MLVIPVLASSFAGAGGSKSAQAVTGADIGFAATIRQAFKHRSYVLLVTGFFVCGFQLAFI
TTHLPPYLTAAGISPGLASWAMALIGLFNVVGSYMSGVLGGKMSKRLLLCANYTLRGLCT
ALFILLPVTPVSVILYAAAMGLLWLSTVPPTSGLVVLMFGTRYLGMLYGFAFLSHQVGGF
LGVWLGGVLYERVGSYDVVWWASVALAFAAAVVNWPITEKPAPALAAEAKA