Protein Info for AZOBR_RS30570 in Azospirillum brasilense Sp245

Annotation: superoxide dismutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00081: Sod_Fe_N
  • amino acids 48 to 134 (87 residues), 99.6 bits, E=1.1e-32
• PF02777: Sod_Fe_C
  • amino acids 142 to 244 (103 residues), 126.9 bits, E=2.9e-41

Best Hits

Swiss-Prot: 59% identical to SODM2_LEPBY: Superoxide dismutase [Mn] 2 (sodA2) from Leptolyngbya boryana

KEGG orthology group: K04564, superoxide dismutase, Fe-Mn family [EC: 1.15.1.1] (inferred from 72% identity to rce:RC1_3229)

Predicted SEED Role

"Manganese superoxide dismutase (EC 1.15.1.1)" in subsystem Nitric oxide synthase or Oxidative stress (EC 1.15.1.1)

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• superoxide radicals degradation (2/2 steps found)
• ethene biosynthesis III (microbes) (5/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.15.1.1

Use Curated BLAST to search for 1.15.1.1

Sequence Analysis Tools

See G8AZD5 at UniProt or InterPro

Protein Sequence (255 amino acids)

>AZOBR_RS30570 superoxide dismutase (Azospirillum brasilense Sp245)
MSVRLDRRQLLLSAGAAALVLAVAPRFVLAQTTGGQTPAGQTPGGKGFTLPPLPYAPAAL
EPHIDATTMSVHHDKHHQAYVDNLNKALANHGDLQAMPLADLLKRVPELPESIRTAVRNN
GGGHANHSMFWSIMGPNAGGAPDGEVGAAITRDFGSFDDFKTRFNTAGAGQFGSGWVFVT
ADPSSGKLAIAARPNQDSPAMDGVPVLMGNDVWEHAYYLKYQNRRADYLAAWWNVVDWGA
VNRRYAAIRKGELVI