Protein Info for AZOBR_RS30150 in Azospirillum brasilense Sp245

Annotation: pyruvate formate lyase-activating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02493: pyruvate formate-lyase 1-activating enzyme
  • amino acids 19 to 249 (231 residues), 301.5 bits, E=3.8e-94
• PF13353: Fer4_12
  • amino acids 28 to 142 (115 residues), 63.2 bits, E=3.4e-21
• PF04055: Radical_SAM
  • amino acids 38 to 196 (159 residues), 73 bits, E=3.4e-24

Best Hits

Swiss-Prot: 42% identical to PFLA_HAEIN: Pyruvate formate-lyase 1-activating enzyme (pflA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 74% identity to azl:AZL_c04450)

MetaCyc: 40% identical to Pfl-activating enzyme (Clostridium pasteurianum)
[Formate-C-acetyltransferase]-activating enzyme. [EC: 1.97.1.4]

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

• mixed acid fermentation (13/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (9/13 steps found)
• reductive monocarboxylic acid cycle (1/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (6/9 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

See G8AZ41 at UniProt or InterPro

Protein Sequence (255 amino acids)

>AZOBR_RS30150 pyruvate formate lyase-activating protein (Azospirillum brasilense Sp245)
ITPQPAHAAGTGASVRGWVHSVETGGTVDGPGLRYVLFLAGCPLRCQYCHNPDTRHMHDG
SPAQSSDVLADIATYADFLHRAHGGLTLSGGEPLVQPEFCAAIYRGAKQLGLHTALDTSG
FLGSHADDHLLADVDLVLLDIKAFKEATYRAVTGVPLRPTLEFAERLSAMRKPIWLRYVL
VPGLTDHLDEIEGLAEFAAGLEVVERVDVLPFHKMGEFKWKQLGLPYALANTEPPPPELT
ERVRGVFRTQGLKVV