Protein Info for AZOBR_RS29910 in Azospirillum brasilense Sp245

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 307 to 330 (24 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 266 (243 residues), 75.9 bits, see alignment E=1.5e-25 amino acids 222 to 385 (164 residues), 42.4 bits, see alignment E=2.2e-15

Best Hits

Swiss-Prot: 44% identical to YGAY_ECO57: Uncharacterized transporter YgaY (ygaY) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 75% identity to npp:PP1Y_Mpl8822)

Predicted SEED Role

"putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AYY5 at UniProt or InterPro

Protein Sequence (392 amino acids)

>AZOBR_RS29910 MFS transporter (Azospirillum brasilense Sp245)
MPHTSTHTPEQTRLGHGLTFAMATAAGLAVANIYYNQPMLSLIEGDLPGPLTGMIPTATQ
LGYAAGLLLLVPLGDLVERRRLIVGQFLLLAAALVATALAQGPALLVAASLLLGVSATVA
QQIVPFAAHLASPQRRGAAVGTVMSGVLTGILLSRTLAGFVGTHEGWRAMFWLAVPLALG
AAALMAVMLPRSHPNASLRYPALMRSLVHLWREFPALRLAAVTQGLLFAAFTTFWTILAL
RLAEPRFGLGADAAGLFGIVGAVGILAAPMAGRIADRSGPHRVILLGTLLTLASWLLFGL
WTSVAGLVAGVILLDFAVQAALVSNQHIVYALRPEARARLNTIFMGGMFLGGALGSSAAT
LAWNAGGWTAVTGLGIAVAAAATALQLAARRR