Protein Info for AZOBR_RS29780 in Azospirillum brasilense Sp245

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 PF02771: Acyl-CoA_dh_N" amino acids 177 to 288 (112 residues), 110 bits, see alignment E=1.7e-35 PF02770: Acyl-CoA_dh_M" amino acids 294 to 394 (101 residues), 58.3 bits, see alignment E=1.4e-19 PF00441: Acyl-CoA_dh_1" amino acids 409 to 558 (150 residues), 138.1 bits, see alignment E=5.4e-44 PF08028: Acyl-CoA_dh_2" amino acids 426 to 545 (120 residues), 51.3 bits, see alignment E=3.1e-17

Best Hits

KEGG orthology group: K14448, (2S)-methylsuccinyl-CoA dehydrogenase (inferred from 68% identity to pla:Plav_1613)

Predicted SEED Role

"Methylsuccinyl-CoA dehydrogenase, predicted by (Erb et al, 2007)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AYV6 at UniProt or InterPro

Protein Sequence (562 amino acids)

>AZOBR_RS29780 acyl-CoA dehydrogenase (Azospirillum brasilense Sp245)
MSSTPTSNGPLPLPDLLSTTAAALDAVARLAEAAERGVAALVAPGGRVDAAALDRHQVAA
HGFAWVATYAEALRQMQGWAERLDCAGRLGELEACMLQAAFGEYLAQLDGGLAMSQGEIV
RPADFGLDDAERAAFRTEAVRRLIAVGNASALRLRIAELLADALHGGGFGEAALEDEALD
MVREQFRRFVADVVEPHAHEWHLKDELIPMPVVEQMAEMGVFGLTVPEEDGGLGMGKLAM
CVVTEELSRGYIGVGSLGTRAEIAAELIRLGGTAEQRARWLPRLASGEILPTAVFTEPNT
GSDLGSLRTRAVLDGDTYRVTGAKTWITHGSRSDLMTLLVRTDPDAPGYRGLSMLLAEKP
RGTEAAPFPAEGMSGGEIPVLGYRGMKEYEIGFDGFAVPRENLLGGVEGQGFKQLMATFE
SARVQTAARAVGVAQNAMELGLRYAQERVQFGRPLAAFPRVAGKIAWMAVETMIARQLTY
FAAREKDSDRRCDIEAGMAKLLAARVAWSNADNAVQIHGGNGYAVEYPISRVLCDARILN
IFEGAAEIQAQVVARGLLTRRN