Protein Info for AZOBR_RS29435 in Azospirillum brasilense Sp245

Annotation: hemin ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 signal peptide" amino acids 1 to 47 (47 residues), see Phobius details transmembrane" amino acids 84 to 107 (24 residues), see Phobius details amino acids 116 to 140 (25 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 273 to 298 (26 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details PF01032: FecCD" amino acids 36 to 361 (326 residues), 264 bits, see alignment E=8.2e-83

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 48% identity to alv:Alvin_1690)

Predicted SEED Role

"Hemin ABC transporter, permease protein" in subsystem Hemin transport system or Iron acquisition in Vibrio or Putative hemin transporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AYS2 at UniProt or InterPro

Protein Sequence (369 amino acids)

>AZOBR_RS29435 hemin ABC transporter permease (Azospirillum brasilense Sp245)
MSLTVSMPSSRKGDRAAPSFRRPPLVPVLAALAAALAVAVLTAVATGGVSVPLDRSLSHL
AALLGLPGTPLSERDWMVLTMLRLARIVLAAAVGVTLGVAGVALQAVFRNPLADPGLVGV
SSGAALAGSAAMVLGVSGLGLARSGLSLATVLPLAAFLGALAATVLILAISRRDGRNSPA
TMLLAGIAVNAIGGAGIGLFSYLGDDLALRQMTFWMMGGFGGSSWAQIGPAMVLMGLATA
GLLAGARRLDLFAMGEREAFLQGLDPHRFAVRTVLLVALGVGAAVAVSGLIGFVGLIVPH
VMRILLGPVHRRLMPATALAAAVLLVLADTVARTIAAPADVPAGLLLGAVGGPFFLWLLR
RRSGGLGGA