Protein Info for AZOBR_RS28940 in Azospirillum brasilense Sp245

Annotation: DNA polymerase III subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF00712: DNA_pol3_beta" amino acids 22 to 137 (116 residues), 37.7 bits, see alignment E=3.1e-13 TIGR00663: DNA polymerase III, beta subunit" amino acids 22 to 408 (387 residues), 198.5 bits, see alignment E=8.1e-63 PF02767: DNA_pol3_beta_2" amino acids 153 to 278 (126 residues), 53.4 bits, see alignment E=4.5e-18 PF02768: DNA_pol3_beta_3" amino acids 281 to 389 (109 residues), 51.7 bits, see alignment E=1.2e-17

Best Hits

Predicted SEED Role

"DNA polymerase III beta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AYG0 at UniProt or InterPro

Protein Sequence (409 amino acids)

>AZOBR_RS28940 DNA polymerase III subunit beta (Azospirillum brasilense Sp245)
MTITAKRPRAARETNSTPVARLTIDSPVLLRAVKAVSLVVARSNTIPILSNVAIKADPAG
TVRLWATDQDIAILRTTPADVPAAFGTTVGAKTLAAVLDAISPGPVTLEPNGAAMRVAIT
AEDVTGEVFALPIEDMPDAPAVQTDKPFQMPAGDLLRLFESVKHCISTEETRYYLNGIFL
RRHGGTLRAVATDGHRMGIASIASPVDGDHKDLDSGVIIPRSAVGMVLRLLAVLPEAAPV
TLTIPNGPDKAARMAFSWEHGGETTEIVTRLVDGTYPDYERVIPKDTTKAFTVYRAMLRR
ALKTVGPALTCDSKGVKLTLNKASLQVSASSPQLGSLSTRVTVASTDVGEIGFNARYVAE
MLDAFDGEAVTFRFEDGAMPCVVEPADDGRPSEQQDRVSLRQVLMPMRV