Protein Info for AZOBR_RS28610 in Azospirillum brasilense Sp245

Annotation: arylesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF00561: Abhydrolase_1" amino acids 24 to 257 (234 residues), 105.1 bits, see alignment E=7.3e-34 PF12697: Abhydrolase_6" amino acids 25 to 262 (238 residues), 79.8 bits, see alignment E=7.4e-26 PF12146: Hydrolase_4" amino acids 39 to 254 (216 residues), 60.7 bits, see alignment E=2e-20

Best Hits

KEGG orthology group: K00433, chloride peroxidase [EC: 1.11.1.10] (inferred from 54% identity to sal:Sala_0477)

Predicted SEED Role

"Non-heme chloroperoxidase (EC 1.11.1.10)" (EC 1.11.1.10)

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AY88 at UniProt or InterPro

Protein Sequence (271 amino acids)

>AZOBR_RS28610 arylesterase (Azospirillum brasilense Sp245)
IQPGFIHTDDGVRLFYRDWGRGRPVVFLSSWSLNSDSWAYQMAALAEHGHRCVAYDRRGH
GRSSDPGVGFDFDRLADDLATLLDTLELEDVTLVGHSMSCGEIIRYLSRHGDRRVSRAVL
VGTVTPTLSRTDDNPDGIDPAVFESFRSDWLMRDFPRWLEDNIRPFMTADSSPGMMAWVK
SMALQASMKALLDCHRATTSTDFRRELQAVTVPTLLIHGDLDVSSPLGITGRKTAELMPN
ATLTIYEGAPHGLFLTHMDRFNRDLMAFLDA