Protein Info for AZOBR_RS28580 in Azospirillum brasilense Sp245

Annotation: alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 252 to 260 (9 residues), see Phobius details PF00465: Fe-ADH" amino acids 12 to 378 (367 residues), 361.8 bits, see alignment E=3.7e-112 PF13685: Fe-ADH_2" amino acids 17 to 277 (261 residues), 37.5 bits, see alignment E=2.4e-13

Best Hits

Swiss-Prot: 34% identical to MEDH_BACMT: NAD-dependent methanol dehydrogenase (mdh) from Bacillus methanolicus

KEGG orthology group: None (inferred from 38% identity to dku:Desku_0628)

MetaCyc: 34% identical to NAD-dependent methanol dehydrogenase monomer (Bacillus methanolicus)
Methanol dehydrogenase. [EC: 1.1.1.244]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1 or 1.1.1.244

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AY80 at UniProt or InterPro

Protein Sequence (387 amino acids)

>AZOBR_RS28580 alcohol dehydrogenase (Azospirillum brasilense Sp245)
MSAFPVSSFSCPTKIVFGVGAHEQLPDVLREWNATRLFVLLDPALADSAIFRRIEGLLTS
NGVALSVFTGIEPEPGDRTVQAAYERCREQDAQALLAIGGGSTIDVAKAVGILMTNGGRI
ADYEGIEKFAIRPLPLIAVPTTAGTGSEVSGACVITDTARKTKMAIRHAAFSPAQVAILD
PLAVGSMPAHVAAHAGIDAFVHAFESYLSKRATVFSDAVNLHAMTLIAGSIRPFVADRTN
VPAALDMLCGSALAAMSFGVTGLGNVHCMAMSVGALFPVPHGLANAVCLPYAAAFNVSAK
PERMARIAEILGVDTAGLPLDQAAEAAVDGLRTLCADLGIPPRLRDVGVTEDRLDEMARR
SYAADYNRWNPRHTSEPDFQDLFRAAF