Protein Info for AZOBR_RS28490 in Azospirillum brasilense Sp245

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF07638: Sigma70_ECF" amino acids 12 to 176 (165 residues), 23.3 bits, see alignment E=1.4e-08 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 23 to 177 (155 residues), 107.8 bits, see alignment E=2.2e-35 PF04542: Sigma70_r2" amino acids 27 to 92 (66 residues), 73.8 bits, see alignment E=2e-24 PF08281: Sigma70_r4_2" amino acids 123 to 174 (52 residues), 52.6 bits, see alignment E=7e-18 PF04545: Sigma70_r4" amino acids 129 to 175 (47 residues), 38.6 bits, see alignment E=1.5e-13 PF04297: UPF0122" amino acids 130 to 175 (46 residues), 23.2 bits, see alignment E=1.7e-08

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 51% identity to rpe:RPE_0783)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AY61 at UniProt or InterPro

Protein Sequence (192 amino acids)

>AZOBR_RS28490 hypothetical protein (Azospirillum brasilense Sp245)
VSGLAAETDEVLMARIRAGDQAAYRALVHRHLKRAYALARRMSGSDAEAEDIAQDAFLQV
WQRRDHWTDEGAKFTTWLYRVVLNRCIDHKRRPAGEDLDSVPEPPDHAPDAVTHIQRRQV
AARLRDAQDRLPQQQRAALALYYNEGLSGAEVATIMQISVTAVESLLKRARQQLRTLLRA
SAQAARDSFEDG