Protein Info for AZOBR_RS28360 in Azospirillum brasilense Sp245

Annotation: radical SAM protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 TIGR04295: B12-binding domain/radical SAM domain protein, rhizo-twelve system" amino acids 2 to 429 (428 residues), 703.1 bits, see alignment E=5.3e-216 PF04055: Radical_SAM" amino acids 211 to 324 (114 residues), 45.3 bits, see alignment E=5.8e-16

Best Hits

KEGG orthology group: None (inferred from 76% identity to mpo:Mpop_1269)

Predicted SEED Role

"FIG00801094: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AY26 at UniProt or InterPro

Protein Sequence (435 amino acids)

>AZOBR_RS28360 radical SAM protein (Azospirillum brasilense Sp245)
MRVALVNPAWTFAHSIYFGCREPHLPLELGYGKALLEQAGHEVLLLDGLLTGLSNSELAD
RVAGFAPGMTVVTTAPTYLFWRCAPPELRIPRDFLLALDGRGGRTVAVGPHGSTTPGAAL
EKLGLDVVVRGECEEVVKQLADRLDSGQPGLDDVPALAFRSGGGTVLTGGPHTGRFVDLP
ALSWPAEWLNRHPHHHHRYGTEPLGAGAEVEASRGCPYTCSFCAKIDFRDQYRRRDTAVV
LEEIDRLTAAGVRYVYFIDEIFLPRRDLLEALVERPVEFGIQTRIDLWKPDLLDLLGAAG
CVSIEAGVESLTEEGRAALDKNCRMSTDALADRLIHARRSVPFVQANLIAMAGDDAGLVA
RWRERLHGAGVWANDPVPLYPYPASPDYRRLWGEPDDRAWERAHEHYLRQFARLSDIQAE
EPLPLHELEAACGCR