Protein Info for AZOBR_RS28155 in Azospirillum brasilense Sp245

Annotation: transcriptional regulator LysR family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF00126: HTH_1" amino acids 7 to 65 (59 residues), 72.8 bits, see alignment E=2.7e-24 amino acids 110 to 166 (57 residues), 53.9 bits, see alignment 2e-18 PF03466: LysR_substrate" amino acids 193 to 397 (205 residues), 113.8 bits, see alignment E=1.2e-36

Best Hits

KEGG orthology group: None (inferred from 43% identity to rle:pRL120275)

Predicted SEED Role

"Transcriptional regulator, LysR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AXY0 at UniProt or InterPro

Protein Sequence (408 amino acids)

>AZOBR_RS28155 transcriptional regulator  LysR family protein (Azospirillum brasilense Sp245)
MNGIPNIRHLRAFREVARRGSISQAAEHVHLSQPAITQAIAKLEEEVGTPLFERRPDGMA
VSAMGVLFLDRVERALDRLRTGTREAVRIGGRKGGLRGVADFDQLLTAAQIRALAAVADA
GNFSLAARTVGISQPTLHRAARDLERLAGMALFARTAAGIALTPAAKALVQHVKLAITEL
EQGFAEVGEGLGGDTARIVVGSMPLSRPFILPTAVNALVRERPDVQFDVLDGPYDDLLHG
LRHGEIDVLIGALRDPLPIDDVVQEPLFEDPLVVVARAFHPLSRRSRLTLEELAGCQWVV
PRRGTPTRDRFETLFAAAPPRGLVETSSQILVRGLLLGSDRLTLISAHQIRHEHELGLLV
ILPVELANTERTIGLTVRRGWRPTATQAHFLDLLREAGKQAVSPVPRP