Protein Info for AZOBR_RS27890 in Azospirillum brasilense Sp245

Annotation: GntR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00392: GntR" amino acids 17 to 71 (55 residues), 46.7 bits, see alignment E=3.1e-16 PF07729: FCD" amino acids 86 to 204 (119 residues), 81.8 bits, see alignment E=8.8e-27

Best Hits

Swiss-Prot: 32% identical to MCBR_ECOLI: HTH-type transcriptional regulator McbR (mcbR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to azl:AZL_b03940)

Predicted SEED Role

"Transcriptional regulator, GntR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AXR8 at UniProt or InterPro

Protein Sequence (227 amino acids)

>AZOBR_RS27890 GntR family transcriptional regulator (Azospirillum brasilense Sp245)
MSGFDLTLLEHDNLGGTIYQKLCEALMKGAFKPNDRLKIRDLADRLGTSVTPVRDAILRL
VQDQALMLRSPRDIRVPMLTRATYLEIRDIRVNLEGLAAARAAVQATPAQIAALDALLKR
NEEAMAAGNTALATELNQIFHFTVSEIADMPVLGDILRRLWLQMGPLIADVYGGAGRTMI
DHHYPLMDAIRSHDGPAAARAIQADILLASGPILERIDGVHPEALAV