Protein Info for AZOBR_RS27845 in Azospirillum brasilense Sp245

Annotation: polyamine ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF00005: ABC_tran" amino acids 26 to 168 (143 residues), 136.4 bits, see alignment E=2.2e-43 PF08402: TOBE_2" amino acids 280 to 354 (75 residues), 33.3 bits, see alignment E=8.9e-12

Best Hits

KEGG orthology group: K11072, spermidine/putrescine transport system ATP-binding protein [EC: 3.6.3.31] (inferred from 50% identity to hau:Haur_1061)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.31

Use Curated BLAST to search for 3.6.3.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AXQ8 at UniProt or InterPro

Protein Sequence (365 amino acids)

>AZOBR_RS27845 polyamine ABC transporter ATPase (Azospirillum brasilense Sp245)
MSATPKPDALLSIRSIDKYFGTYHALRDVSLDVAHGEFVALLGPSGCGKTTLLRCIAGFL
SPDSGTIRIGGEDVTRLPPHRRPLNTVFQHYALFPHLSILDNVAYGPRRHGVARGEALER
AREALELVGLDSAAGRHPRELSGGQQQRVALARAFVNRPKLLLLDEPLSALDLKLRKRMQ
IELKHLQEKLGIAFVFVTHDQEEAMSMANRIVVMNRGVIEQVGDGRAIYTRPASRFVADF
IGEANLLPGTAEGDAGVRLAVGSALLPHLGADTRQRYTAVLRPEHVELLKEPEAPGLITD
QGFVEDVIDTGGQTVVTVRVGEHLLASRRLGMAGEGLNPGAPVFVGFRPGHVHIIAEPAT
HRSGP