Protein Info for AZOBR_RS27830 in Azospirillum brasilense Sp245

Annotation: proline racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF05544: Pro_racemase" amino acids 11 to 334 (324 residues), 304.2 bits, see alignment E=5.3e-95

Best Hits

Swiss-Prot: 80% identical to 4HYPE_RHOS4: 4-hydroxyproline 2-epimerase (RSP_3519) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K01777, proline racemase [EC: 5.1.1.4] (inferred from 83% identity to sno:Snov_3198)

Predicted SEED Role

"Proline racemase (EC 5.1.1.4)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 5.1.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AXQ5 at UniProt or InterPro

Protein Sequence (337 amino acids)

>AZOBR_RS27830 proline racemase (Azospirillum brasilense Sp245)
MRMQDAFDVLYTHTEGEPLCIIHSGIPYPAGSSILEKRQFLETHYDWLREALMREPRGHK
DMFGVFLTPPSGPDYDAGLIYIDGTQYSHMCGHGTIAVAMAMVANGLVRRGENGRTIIRF
ETTAGLVVAEVAHEGDRVLWTKFENVPAYVAAQDVEFELPEIGPLKADIVWGGNYFGIID
LTGTSLRIGPENGTALSHYGILAREQLRQKVAIQHPASAHINNFNFVTFWHEPTIEGAFY
KNVHVFSAGQLDRSPGGTGTSAMMAMFEARGKMAIGDTIRSEGLLGTGTFEGSLLGETRL
NGVRAVRPTVKGTASILGTARWVIDRNDPVGAGFLVA