Protein Info for AZOBR_RS27790 in Azospirillum brasilense Sp245

Annotation: nitrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 165 to 197 (33 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 74 to 244 (171 residues), 75.4 bits, see alignment E=2.6e-25

Best Hits

KEGG orthology group: None (inferred from 50% identity to azc:AZC_2469)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AXP7 at UniProt or InterPro

Protein Sequence (248 amino acids)

>AZOBR_RS27790 nitrate ABC transporter permease (Azospirillum brasilense Sp245)
LTAMHGKTDTLLVIVALVALWQVLHWIVGSVALTSPADTLARAVELLGSATFWPHVAETG
VALLYSLLLAVLGGLTIGIALGINRLAGEVAEPILVSLYSLPKITLYPVILLAFGLGLSA
KVAFGTIHGIIPVIIFTMNAVRTIPPVMLRSARVMRLSPPQLVSTIILPAALPELVSGLR
VGFSLTLLGVLIGEMFASQRGLGYLVMNAIGGHDVRTMMAVVLILATTAVLISAGLLHID
RRMHRRAS