Protein Info for AZOBR_RS27570 in Azospirillum brasilense Sp245
Annotation: MerR family transcriptional regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to HMRR_SINMW: HTH-type transcriptional regulator HmrR (hmrR) from Sinorhizobium medicae (strain WSM419)
KEGG orthology group: None (inferred from 62% identity to acr:Acry_3237)Predicted SEED Role
No annotation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8AXK2 at UniProt or InterPro
Protein Sequence (143 amino acids)
>AZOBR_RS27570 MerR family transcriptional regulator (Azospirillum brasilense Sp245) MAQQDLSIGALGKMTGTKVETIRFYEKIGILPAPARTAGNYRSYGHDHVRRLTFVRRVRD LGFPLETVRAMLDLADQPDRPCGEVDALVLEQLHEVERKIADLERLREELDRLAHQCRRG GRMAECRIIEALSPHHEDGRCCP