Protein Info for AZOBR_RS26930 in Azospirillum brasilense Sp245

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 221 to 251 (31 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 276 (269 residues), 113 bits, see alignment E=7e-37

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 88% identity to azl:AZL_d00550)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AX47 at UniProt or InterPro

Protein Sequence (289 amino acids)

>AZOBR_RS26930 ABC transporter permease (Azospirillum brasilense Sp245)
METLFGIVVDGVAYGMILFIISVGLSVTLGLMRVVNLAHGAFAMVAGYVASYAAQGLGLP
YAVGLVAAILFTVLATLPLEKLLYRRIYGSANELAQVLLTIGLTFVIVAGINYLFGPTLK
RIPLPDALLGTVAIGPKSIPVHRAFVIAMGAATVLGLWWLLERTDFGIKLRAAVDDPNMA
AALGIRTERLYTATFALGTGLAALGGVLGAELLPLEPYYAIRYIVLFLAVVAVGGAGNIL
GSAAAALALGIVDTAGKYLIPSFGEFFFYAALILILFRWPHGFFQGRAA