Protein Info for AZOBR_RS26860 in Azospirillum brasilense Sp245

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 67 to 95 (29 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details PF01891: CbiM" amino acids 2 to 198 (197 residues), 110 bits, see alignment E=7.4e-36

Best Hits

KEGG orthology group: None (inferred from 59% identity to azc:AZC_0148)

Predicted SEED Role

"Predicted cobalt transporter CbtC" in subsystem Coenzyme B12 biosynthesis or Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AX32 at UniProt or InterPro

Protein Sequence (217 amino acids)

>AZOBR_RS26860 conserved membrane protein of unknown function (Azospirillum brasilense Sp245)
MHIEPGMLSAAKIVGANAAALSLLASHVPAFLRRPLEWGKALLAAIFFSVFMEFWHQPVG
PSELHFIGASAIYFIFGFPATLFGFGIGLTLQALLFEPQDLGHLAVNSLSLMVPLVAAHA
MGGKRLLESGGLASIRWSSVLRFDAVYYSGVVAMVGFWLMLGERATPFADWAVFAAAYLP
VVLCEPAISCGLLRALGRLDAGNPLLRVTTLRSPALA