Protein Info for AZOBR_RS26780 in Azospirillum brasilense Sp245

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 PF13185: GAF_2" amino acids 26 to 159 (134 residues), 42.1 bits, see alignment E=2e-14 PF01590: GAF" amino acids 28 to 159 (132 residues), 37.8 bits, see alignment E=5.5e-13 PF00512: HisKA" amino acids 188 to 247 (60 residues), 30.1 bits, see alignment E=8.2e-11 PF02518: HATPase_c" amino acids 299 to 406 (108 residues), 88.9 bits, see alignment E=6.4e-29

Best Hits

Predicted SEED Role

"Osmosensitive K+ channel histidine kinase KdpD (EC 2.7.3.-)" in subsystem Potassium homeostasis (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AX11 at UniProt or InterPro

Protein Sequence (412 amino acids)

>AZOBR_RS26780 hypothetical protein (Azospirillum brasilense Sp245)
LQPSALRDADHLTAIIDLNERLFFARDLPAVVSILRTAARRLTGADGVTIVLRDGDLCHY
VEEDAISPLWKGQRFPMGTCISGWAMLTGQPAVIPDIYADPRIPHEAYRPTFVRSLVMVP
VGAPDPIAAIGAYWATRHTPDAGTVTLLLAIARSAALALSNVRLLESLQEAAEAARAQAR
EVGRANAARTRLLATLSHDLRQPVHALTLATHALSSRVTPRGEIYVSTMKHCLGVVKRLM
DGVQDLVGMDDGTIAVRIEDVPLDDLMTHATATFQLAAEAKGLDWRMEGSGSGVTVRTDR
LIASRILHNLVDNAIKYTDHGEIRIVCRTADDRVWLDVCDTGRGIPESSLADIFEEFYRI
EAGNEVVGLGLGLFIVKTLADHLGYPITVESRPGAGTTISVALPLAGSVARP