Protein Info for AZOBR_RS26665 in Azospirillum brasilense Sp245

Annotation: conserved hypothetical protein; putative signal peptide; twin-arginine translocation signal domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF13462: Thioredoxin_4" amino acids 45 to 208 (164 residues), 135 bits, see alignment E=3e-43

Best Hits

KEGG orthology group: None (inferred from 48% identity to azl:AZL_c00580)

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AWY3 at UniProt or InterPro

Protein Sequence (216 amino acids)

>AZOBR_RS26665 conserved hypothetical protein; putative signal peptide; twin-arginine translocation signal domain protein (Azospirillum brasilense Sp245)
MTVLPFNRRRAVTLLGAIGLLAGAPMALAQSPAAAPAPAAPATATTPRVLGSPDAPVEVV
EYASLTCHHCAAFHNEVLPQVKKELIDTGKIRIVYRDFPLDRAALDAAVLARCVPPGRYF
AILSVLFAKQDDWSHAKDPRESLSRYGLLAGLPKETYQACLDDQALSDAILQSRLDGAEK
HQIDSTPSFVIDGKTHKGVLSYEAFLNAVRPLLPPS