Protein Info for AZOBR_RS26405 in Azospirillum brasilense Sp245

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 19 to 166 (148 residues), 125.7 bits, E=3.2e-40

Best Hits

Swiss-Prot: 55% identical to GLNQ_GEOSE: Glutamine transport ATP-binding protein GlnQ (glnQ) from Geobacillus stearothermophilus

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 80% identity to bja:bll3978)

MetaCyc: 53% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21 or 7.4.2.1

Sequence Analysis Tools

See G8AWS5 at UniProt or InterPro

Protein Sequence (242 amino acids)

>AZOBR_RS26405 amino acid ABC transporter ATP-binding protein (Azospirillum brasilense Sp245)
MALVDIKNVTKSYGSIEVLKGVSLSIDEGEIVTIIGKSGSGKSTLLRCINALERIDGGAI
TVEGQSVRTDMPNLRGFRQRVGIVFQAFNLFPHLTVERNITLAPILNKRIAKAEGRALAL
DVLARVGLADKIDAYPAQLSGGQQQRVAIARCLAMGPHLMLFDEVTSALDPELVGEVLKV
MEDMARQGMTMVLVTHEMGFARNVASKIVFMHQGRVWEEGPPAELFANPRTPELRSFIAS
AR