Protein Info for AZOBR_RS26395 in Azospirillum brasilense Sp245

Annotation: endoribonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF01042: Ribonuc_L-PSP" amino acids 4 to 113 (110 residues), 93.1 bits, see alignment E=6.5e-31

Best Hits

Swiss-Prot: 40% identical to Y322_HAEDU: RutC family protein HD_0322 (HD_0322) from Haemophilus ducreyi (strain 35000HP / ATCC 700724)

KEGG orthology group: None (inferred from 79% identity to bja:bll3976)

Predicted SEED Role

"RidA/YER057c/UK114 superfamily, group 2, YoaB-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AWS3 at UniProt or InterPro

Protein Sequence (114 amino acids)

>AZOBR_RS26395 endoribonuclease (Azospirillum brasilense Sp245)
MITRFQVGSRMSQAVVCQGMVHIAGQVANNRKGSIGEQTRDVLAKIDALLEEAGTDKSKL
VAVNVFLPHITDFDAMNEVYDAWINPANPPARACTEARLADPDLRVEMTALAAL