Protein Info for AZOBR_RS26240 in Azospirillum brasilense Sp245

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 104 to 130 (27 residues), see Phobius details amino acids 150 to 177 (28 residues), see Phobius details amino acids 223 to 248 (26 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details PF12911: OppC_N" amino acids 21 to 73 (53 residues), 40.2 bits, see alignment 2.6e-14 PF00528: BPD_transp_1" amino acids 120 to 300 (181 residues), 88 bits, see alignment E=6.9e-29

Best Hits

Swiss-Prot: 38% identical to DPPC_HAEIN: Dipeptide transport system permease protein DppC (dppC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 70% identity to sit:TM1040_3601)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AWN7 at UniProt or InterPro

Protein Sequence (304 amino acids)

>AZOBR_RS26240 peptide ABC transporter permease (Azospirillum brasilense Sp245)
MTMSETLRAPAASAAAAPPPTPGQILRRRILGHWSLMGGLAVLGLILLLAVLAPFVAPDD
PYRQDLMERLVPPVWNAEGSWTHPLGTDHLGRDYLSRLLYGARVSLLIGFAAALGSGVIG
TTLGVCAGYFRGRVDMVVTFLVTVRLSTPVVLVALAVVALFGGSLEVVILVLSALLWDRF
AIVMRTSTIQATSQDYVLAAQAVGCSVPRIIFGEILPNVLNNLIIVATLEMAHAILLEAA
LSFLGLGVQPPLPSWGLMVAEGRSNLFFEPWLIAIPGVALFLLVLAINLVGDGVRDVTAP
DGRT