Protein Info for AZOBR_RS24640 in Azospirillum brasilense Sp245

Annotation: uracil-DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 TIGR03915: probable DNA metabolism protein" amino acids 10 to 236 (227 residues), 202 bits, see alignment E=1.3e-63 PF13566: DUF4130" amino acids 75 to 235 (161 residues), 134 bits, see alignment E=4.3e-43 TIGR03914: uracil-DNA glycosylase family domain" amino acids 239 to 462 (224 residues), 283.9 bits, see alignment E=9.8e-89 PF03167: UDG" amino acids 304 to 461 (158 residues), 99.4 bits, see alignment E=2e-32

Best Hits

KEGG orthology group: K02334, DNA polymerase bacteriophage-type [EC: 2.7.7.7] (inferred from 65% identity to mch:Mchl_2581)

Predicted SEED Role

"Domain often clustered or fused with uracil-DNA glycosylase / Uracil-DNA glycosylase, putative family 6"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AVF7 at UniProt or InterPro

Protein Sequence (467 amino acids)

>AZOBR_RS24640 uracil-DNA glycosylase (Azospirillum brasilense Sp245)
MHTITLREGADLDGFRRAVRRLAASRTEPDTVLWSVGAPSLFGDDAAPASENGLPLFLPH
AVGQLIETVVCHGDPERYALLHRLVWRVLNGERALLDQHADPLVHRLERLDKAVRRDIHK
MHAFLRFRALPDPDGGERYVAWFEPDHHIVEAVAPFFVERFESMVWTILTPKGSLHWDRQ
HLMTGPPAERPDSLADDRFAEGWLRYYESTFNPARVNPTAMRAEMPRKYWVNMPETAAIP
AMVRSAPARVQAMLEAEAAIPRRRTPEKAVAAMARQAPESLADLNRLIQRSEPLVPGATQ
AVLGEGPEGAAIAIVGEQPGDQEDREARPFVGPAGQLLTAALEEAGIDRGSLYLTNAVKH
FKFVQRGKRRIHQSPTAGEVKHYRWWLMTELGFVRPRLVVALGATAALALSGRPVAVLRE
RGPMAFDGWDGFVTVHPSYLLRLPGDEERRRAQAEFVADLRRAAALA