Protein Info for AZOBR_RS24405 in Azospirillum brasilense Sp245

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF13426: PAS_9" amino acids 21 to 112 (92 residues), 37 bits, see alignment E=6.9e-13 PF08448: PAS_4" amino acids 23 to 113 (91 residues), 27.2 bits, see alignment E=7.7e-10 TIGR00229: PAS domain S-box protein" amino acids 24 to 113 (90 residues), 43.5 bits, see alignment E=1.6e-15 PF00989: PAS" amino acids 25 to 112 (88 residues), 35.7 bits, see alignment E=1.6e-12 PF08447: PAS_3" amino acids 32 to 113 (82 residues), 48.3 bits, see alignment E=2e-16

Best Hits

KEGG orthology group: None (inferred from 66% identity to azl:AZL_007490)

Predicted SEED Role

"putative sensor (PAS) domain for methyl-accepting chemotaxis sensory transducer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AVA5 at UniProt or InterPro

Protein Sequence (174 amino acids)

>AZOBR_RS24405 chemotaxis protein (Azospirillum brasilense Sp245)
MANRHHPLTGFERTFDPGELIVTKTDLKGRITYANRVFLRISGYDEHEVIGAPHNILRHP
DMPACVFKLLWDTIGAGREIFAYVDNRAKTGDHYWVFAHVTPSFDENGTAIGYHSNRRVP
RRDAVETIRPLYAQLLAEERRHANPKAAMVASTALLSDLLKRNGTTYDKFIFAL