Protein Info for AZOBR_RS24375 in Azospirillum brasilense Sp245

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 47 to 64 (18 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 314 to 336 (23 residues), see Phobius details PF00092: VWA" amino acids 111 to 293 (183 residues), 60.1 bits, see alignment E=3.3e-20 PF13519: VWA_2" amino acids 112 to 225 (114 residues), 51 bits, see alignment E=2e-17

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 68% identity to met:M446_1204)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AV97 at UniProt or InterPro

Protein Sequence (359 amino acids)

>AZOBR_RS24375 membrane protein (Azospirillum brasilense Sp245)
VAPDPPRSGIKTERLAMLTLAYPWLLLLLPLPWIVHRMVPPRIERRPAVRVPFFATLVAL
TGAAPQGGTAVARRGIWRTAVLILCWCLSVGALARPQWIEPPLHRDQPARDLLLLVDLSG
SMETRDFTDASGVAVDRLTAVKQVLDDFLSRRDGDRVGVVVFGNAPFTLVPFTADLGLCR
RLVQEMQVGMAGPRTVFGDAIGLGITLFERSTVPAKTIIALTDGNDTASRVPPAEAARVA
KDKAITIHTIAIGDPTAVGEDALDEKALRDVADATGGGFFRALDRTQLAEVYQRLDAIET
RKVDTVSVRPRTDLFWVPLAALTILSMAAQTLGLLPRLRRGSPSGRADGHSAATPGVRP