Protein Info for AZOBR_RS24280 in Azospirillum brasilense Sp245

Annotation: Cro/Cl family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 PF13560: HTH_31" amino acids 6 to 60 (55 residues), 41.8 bits, see alignment 2.7e-14 PF12844: HTH_19" amino acids 8 to 61 (54 residues), 34.8 bits, see alignment 3.4e-12 PF01381: HTH_3" amino acids 10 to 62 (53 residues), 47.5 bits, see alignment 3.8e-16 PF06114: Peptidase_M78" amino acids 188 to 313 (126 residues), 59.8 bits, see alignment E=5.9e-20 PF09856: ScfRs" amino acids 314 to 470 (157 residues), 235.5 bits, see alignment E=6.3e-74

Best Hits

Swiss-Prot: 52% identical to PRPR_MYCTU: HTH-type transcriptional regulator PrpR (prpR) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K07110, (no description) (inferred from 68% identity to rru:Rru_A2316)

Predicted SEED Role

"Transcriptional regulator, XRE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AV69 at UniProt or InterPro

Protein Sequence (477 amino acids)

>AZOBR_RS24280 Cro/Cl family transcriptional regulator (Azospirillum brasilense Sp245)
MAKAFMGVRLQRLREERGLTQTALARILEISPSYLNQLERNQRPLTVPLLLRINAAFGID
VQIFSEDEEARLVADLREALSEAGTGETIAMAEIKALATNMPAVGRALVALHRRGRGLAE
RLDALASGVVPAGPDSGLPPPMPYEEVRDFFYRHHNHIAALDDAAERLFGEAGLEVGAVD
RGLERLLADRHGIRTLVTDDTAMPEGALRQYDGDARTLRIARSLEPGRRAFQMATQLAFH
QEPALLLRLVEEGRFSGPQARSLARIGLANYYAGAVVMPYRAFRETAEAVAYDIDLLGQR
FCTGFETVCHRLSTLQRPGMPGVPFFFVRVDRAGNMSKRQSATSFHFSRVGGTCPLWNVY
EAFSTPGRLLTQLARMPDGRAYLWIARTVVHGRSGYGAPSKSFAVGLGCDIQHAGRLIYS
RGLALGDPDAATPIGAGCKVCERPYCPQRAFPPIGRTVTVDESLSRFEPYPVAQPPV