Protein Info for AZOBR_RS23635 in Azospirillum brasilense Sp245

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 61 (25 residues), see Phobius details amino acids 73 to 100 (28 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 166 to 183 (18 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 285 to 309 (25 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 378 to 400 (23 residues), see Phobius details amino acids 412 to 430 (19 residues), see Phobius details amino acids 436 to 460 (25 residues), see Phobius details PF01943: Polysacc_synt" amino acids 10 to 268 (259 residues), 35.1 bits, see alignment E=1.6e-12 PF13440: Polysacc_synt_3" amino acids 25 to 317 (293 residues), 66.8 bits, see alignment E=3e-22 PF14667: Polysacc_synt_C" amino acids 323 to 453 (131 residues), 36 bits, see alignment E=1.2e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AUP9 at UniProt or InterPro

Protein Sequence (477 amino acids)

>AZOBR_RS23635 conserved membrane protein of unknown function (Azospirillum brasilense Sp245)
MMSSGFAFFATRIAVGILGFAAVAVFSRIVTPEAYGHYALVMAAAAAINACGFSWMGLFV
LRKCGGDAAERDAWLSTVVTAFLVVACGVLAILGAVVAFYPGMNGIDYVLYLPVIAILIS
WFDLSIQMSRARLKGSVFAAKSFAKALFGLALGSAFVLIGWKEEGLLLGTSIGFLLVTAI
WLRSDLKGISLRWPARERVGLLLTFGGPLMLSLMVGWALDFADRFLIYWFIGEAAAGAYA
MAFDLAKQPIMLVASAASLVTLPMASRAFDSAGPRAARPIMAQNLTILLLVCLPLVLMEV
ISAQGIVGLLLGEAYRETGAAIMPLVALSVFISILRIYHFDLSLHLTKKTGYILKLTMLT
AVLNIGANLFLIPRFGVIGAAYGSLAAQLGWVVAAVILMPRAGVLAVPVKDLLKVTTAAL
LFAAGLKIAAMESDLLLVQLAPAGSLYLLALAVLNPANLMGQVRIALARLKRTRSPA