Protein Info for AZOBR_RS23385 in Azospirillum brasilense Sp245

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 TIGR00492: alanine racemase" amino acids 14 to 364 (351 residues), 182.7 bits, see alignment E=4.8e-58 PF01168: Ala_racemase_N" amino acids 18 to 242 (225 residues), 155.5 bits, see alignment E=1.8e-49 PF00842: Ala_racemase_C" amino acids 255 to 381 (127 residues), 83.8 bits, see alignment E=8.1e-28

Best Hits

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.1

Use Curated BLAST to search for 5.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AUJ4 at UniProt or InterPro

Protein Sequence (392 amino acids)

>AZOBR_RS23385 alanine racemase (Azospirillum brasilense Sp245)
MTGTRTGRRGSTTAWADIDLHALGRNLERLRRSLPPGQAVFGVVKADAYGHGAGPVGRAL
QRFEIDGLVVADMGEGITLRRAGVTAPILVIDPPLPSQLRLPALHRLGATVTSAAEARAL
ATAANRAGRMVDVHVRVNTGFAGFGGPRADLTDLLAAVAAAPALRLEGLYTHLSGAYGPY
EDGGLAELERSGAVEAVRATGLLPPLVHALSSAALGRPLLTGAAARIGCTAVRCGAALFG
IRMVDGELPLPLAPVMSVKARVTRVTALEPGDAADYAAASAAPRRTPVAVLPFGFSDGHH
LHRLAGGILLIRGRPAPVLGRPFMSSLLADLTDVPGVQPGDEAVLIGRQGDHRITVEDIA
ARSGLRPSAIPLLGPRVVRRYRSSAAGEDQTE