Protein Info for AZOBR_RS23315 in Azospirillum brasilense Sp245

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 85 to 117 (33 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details PF07331: TctB" amino acids 7 to 148 (142 residues), 71.7 bits, see alignment E=3.6e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AUH8 at UniProt or InterPro

Protein Sequence (161 amino acids)

>AZOBR_RS23315 conserved membrane protein of unknown function (Azospirillum brasilense Sp245)
MKVQDVLVGLFFIVIGVLMIEYAADLKPPRHLKFGPGFFPLLIGSGLILVGGVIALLGLR
TLRTEPLWHRPEWSRTRQGWVRFCSVPAAVALYVLIVDAAGFLLTAVLVMVLVLAVSGEP
LRRSVPAGAVTAVVLTAIFASVLHVPLPWGPLQNISGWLLW