Protein Info for AZOBR_RS21135 in Azospirillum brasilense Sp245

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 300 to 319 (20 residues), see Phobius details amino acids 432 to 451 (20 residues), see Phobius details PF02743: dCache_1" amino acids 35 to 285 (251 residues), 50.8 bits, see alignment E=2.4e-17 PF00512: HisKA" amino acids 366 to 432 (67 residues), 36.3 bits, see alignment E=7e-13 PF02518: HATPase_c" amino acids 477 to 583 (107 residues), 86.3 bits, see alignment E=3.1e-28

Best Hits

KEGG orthology group: K10125, two-component system, NtrC family, C4-dicarboxylate transport sensor histidine kinase DctB [EC: 2.7.13.3] (inferred from 71% identity to azl:AZL_a05640)

Predicted SEED Role

"MISCELLANEOUS; Not classified regulator"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8APC2 at UniProt or InterPro

Protein Sequence (588 amino acids)

>AZOBR_RS21135 histidine kinase (Azospirillum brasilense Sp245)
MPLLFARPRRVMLAVLVVGMPLAAAVAAGLAADNAGESLREQGSAQLSLYESNLRTELER
HAAVPMVLARDQEVADLLRDPSPERVDRLNRKLEAIAATLNASALYVMNGAGTTVAASNW
NASPSFVGQNFSYRPYFQSAMERGEGHHFALGTTSLVPGYYTAQRVVAENRTDGRPGGRP
AGVVVLKVGFQELERAWSHGQEKVLVSDRDGVVFITNVEGWRYNALPRRLPVTLPAAAVP
ATEEIPTLPWAFGGASDRITLREGNAERRYLLQSAAVPGGDWTIHALTSLAPVATRAQQA
GLLAAAVVALAALTGHALAQRRLNLVERLALQEEARAELERRVAAATAELRATENELTQA
AKLAALGQMSAAMAHEINQPLAAIRSFADNAVVLLERGRPDAVRDNLAEIADLTDRMAAI
TRSLKGFARRASGTLGAVSAAAAIGQALALLEARLRRESVTVDTDLPPGPLLVTGEDVRL
QQVLVNLIGNAADAMRASPHRHVRIALAAEGEEAVLTVRDSGPGIAEADLPRMFVPFFTT
KEAGDGLGLGLSISHGIVEDFGGSLTAANHPEGGALFTIRLKRRDIQT