Protein Info for AZOBR_RS20475 in Azospirillum brasilense Sp245

Annotation: homoserine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 TIGR01392: homoserine O-acetyltransferase" amino acids 23 to 379 (357 residues), 469.8 bits, see alignment E=2.6e-145 PF00561: Abhydrolase_1" amino acids 52 to 366 (315 residues), 74.2 bits, see alignment E=6.9e-25

Best Hits

Swiss-Prot: 76% identical to METXA_RHORT: Homoserine O-acetyltransferase (metXA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00641, homoserine O-acetyltransferase [EC: 2.3.1.31] (inferred from 86% identity to azl:AZL_a03900)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.31

Use Curated BLAST to search for 2.3.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ANW5 at UniProt or InterPro

Protein Sequence (394 amino acids)

>AZOBR_RS20475 homoserine acetyltransferase (Azospirillum brasilense Sp245)
VPAAAPAEPATMPGHRVTLGVDRPMRLDSGAELGPFEVAYQTYGALNADRSNAILICHAL
TGDHYVLDQHPVTGKPGWWEMLVGPGKPVDTDRYFVICSNVIGGCMGSTGPKETDPATGE
PYGLGFPVITIGDMVRAQKLLVEHLGIDQLFCVIGGSMGGMQVLQWAVAYPESVFAAVPI
ATAARHSAQNIAFHEVGRQAIMADPDWAGGNYLLEGTRPHRGLAVARMAAHITYLSEPAL
HRKFGRNLQNRQTVTYGFDADFQVESYLRHQGITFVERFDANSYLYITRAMDYFDLAADY
GGGTLSNAFRKDGKGTPVRFCLASFSSDWLFPTSESRAIVHALNAVAANVSFVEIRTDKG
HDSFLLDEPEFHQVIRGFLDGCAEHRGLTRPSRP