Protein Info for AZOBR_RS20350 in Azospirillum brasilense Sp245

Annotation: hydrogenase nickel incorporation protein HypB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 TIGR00073: hydrogenase accessory protein HypB" amino acids 91 to 300 (210 residues), 298 bits, see alignment E=1.8e-93 PF02492: cobW" amino acids 120 to 280 (161 residues), 84.7 bits, see alignment E=3.1e-28

Best Hits

Swiss-Prot: 57% identical to HYPB_BRADU: Hydrogenase maturation factor HypB (hypB) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K04652, hydrogenase nickel incorporation protein HypB (inferred from 60% identity to rpt:Rpal_1166)

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation-associated protein HypB" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ANU0 at UniProt or InterPro

Protein Sequence (310 amino acids)

>AZOBR_RS20350 hydrogenase nickel incorporation protein HypB (Azospirillum brasilense Sp245)
MCTVCGCAEGETKIEAGHAHGHHHHHGHDHDHHDHDHHHHDHSHEHVGPDGKVYRHTHGD
DHGHGHDHGTIDLGRGPAGTEVPGMSQTRLVAIEQDILAKNDSFAAVNRQLFAAKGVFVL
NLMSSPGSGKTTLLTRTLTDLKGRFPMAVIEGDQQTSFDADRIRATGTPAIQVNTGKGCH
LDAQMVTQAVGRLPVETGSVLFIENVGNLVCPAGFDLGEAHKVVVLSVTEGEDKPLKYPA
MFAGADLLLVNKVDLLPHLTFDVARMIAYARQLNPDLRVIEVSATAGQGLEDWYDWIEEG
LAKAVAERGA