Protein Info for AZOBR_RS20320 in Azospirillum brasilense Sp245

Annotation: carboxyl-terminal protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 100 to 420 (321 residues), 288 bits, see alignment E=4.5e-90 PF00595: PDZ" amino acids 137 to 207 (71 residues), 36.5 bits, see alignment E=1.1e-12 PF13180: PDZ_2" amino acids 139 to 212 (74 residues), 41.3 bits, see alignment E=3.2e-14 PF17820: PDZ_6" amino acids 156 to 210 (55 residues), 35.4 bits, see alignment 1.6e-12 PF03572: Peptidase_S41" amino acids 245 to 410 (166 residues), 156.2 bits, see alignment E=1.2e-49

Best Hits

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ANT4 at UniProt or InterPro

Protein Sequence (482 amino acids)

>AZOBR_RS20320 carboxyl-terminal protease (Azospirillum brasilense Sp245)
MAKLLAALLLLMVAMGPACAVVPASRADTSIALEHYRQEFAKAKGTSSLPSPADRNYLLF
SDVLRRVLAEHVKPGTPQVLVEKAVAGLQKKKKEEPGATDRTLTEAALDAMLTSLDPYSA
FLDSEHFRYMREQTQGEFGGLGIEVTMDEDSGLIRVVSPIDGSPASRAGLRTGDLIARID
EAQVKGMNLRDAVARMRGPVGTSVALTMRRNGGNSGNGGPDAPFRVSLTRAIVKIQPVRY
RLEGDVAYIRIAAFNQQTSHALDDAVEEMRRQAHGRLAGAVLDLRNNPGGLLDQAVNVAD
RFLEAVDIVSVRGRDPDENRRYTGTPGDLLAGLPIVLLINSGSASASEIVAGALQDHSRA
LLFGTRSYGKGSVQTISSLSGDIGIRLTTARYFRPSGGLVDCFGVSPNLEIKPANDNSEE
THPDPATCDPHATPPPPPRAWRIEDLCPDVAAAPSKADADRPLDCAVAAIRTRLMGTLIG
RP