Protein Info for AZOBR_RS20295 in Azospirillum brasilense Sp245

Annotation: modification methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF01555: N6_N4_Mtase" amino acids 24 to 244 (221 residues), 223.5 bits, see alignment E=3.5e-70 PF18755: RAMA" amino acids 258 to 359 (102 residues), 58.1 bits, see alignment E=7.6e-20

Best Hits

Swiss-Prot: 63% identical to MTB1_OCHA4: Modification methylase BabI (ccrM) from Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)

KEGG orthology group: K13581, modification methylase [EC: 2.1.1.72] (inferred from 88% identity to azl:AZL_d02330)

Predicted SEED Role

"Modification methylase"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ANS9 at UniProt or InterPro

Protein Sequence (361 amino acids)

>AZOBR_RS20295 modification methylase (Azospirillum brasilense Sp245)
MLPLNKILVGDCIALMNEMPAESVDLVFADPPYNLQLGGELLRPNHSRVDGVEEDWDKFE
DFETYDRFTRDWLAAARRILKPEGSLWVIGSYHNIFRVGATLQNLGFWILNDIVWRKTNP
MPNFRGTRFANAHETMIWASREKDARYRFNYDAMKALNDDLQMRSDWLLPICNGAERLRD
EDGRKAHPTQKPESLLYRVILSSSRPGDTVLDPFFGTGTTGAVAKRLGRNWIGLERDPTY
AKAATARIEAVEEAPDAAVLDTPPKRSAPRIPFGWVVERGLLRPGTSLFDLRRRVVARVR
ADGTLIGAGPRGEHRGSIHQVGAAMAGLPACNGWTFWHYEDGGDLRPIDVLRERIRSEAS
A