Protein Info for AZOBR_RS20105 in Azospirillum brasilense Sp245

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF00126: HTH_1" amino acids 6 to 65 (60 residues), 80 bits, see alignment E=9.9e-27 PF03466: LysR_substrate" amino acids 89 to 290 (202 residues), 124.7 bits, see alignment E=3.6e-40

Best Hits

Swiss-Prot: 40% identical to GCVA_ECO57: Glycine cleavage system transcriptional activator (gcvA) from Escherichia coli O157:H7

KEGG orthology group: K03566, LysR family transcriptional regulator, glycine cleavage system transcriptional activator (inferred from 50% identity to azl:AZL_015620)

Predicted SEED Role

"Glycine cleavage system transcriptional activator GcvA" in subsystem Glycine cleavage system or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ANN2 at UniProt or InterPro

Protein Sequence (301 amino acids)

>AZOBR_RS20105 transcriptional regulator (Azospirillum brasilense Sp245)
MQIPPLNGLRAFEAAARHLSFTRAAEELNVTQSAISHQIRTLEDRLGIRLFRRLNQALVL
TDAGQLLLPSVRDAFARLATGLERVMEHERSGVLTMSVSPSFASRWLMSRIGRFRARHPE
IHLRISVSQHEIDFEREADIDIGLRHGLGVWEGLRADRFLDDAVFPVCSPALLQGSTPLR
QPADLRHHVLVEETGHSYWATWLAMAGLGDLKPSSEMVFDEIGIAIEAAENGQGIAMARG
TLVLEELASGRLTRLFDLALPGDFGYYLVCPEVTADRPKITAFRRWIMEEGAADRLTVTP
P