Protein Info for AZOBR_RS19360 in Azospirillum brasilense Sp245

Annotation: glycosyltransferase family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 63 to 82 (20 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 57 to 178 (122 residues), 33.2 bits, see alignment E=1.5e-11 PF13579: Glyco_trans_4_4" amino acids 65 to 176 (112 residues), 34.7 bits, see alignment E=6.6e-12 PF20706: GT4-conflict" amino acids 174 to 301 (128 residues), 29.8 bits, see alignment E=9.1e-11 PF00534: Glycos_transf_1" amino acids 199 to 350 (152 residues), 103.5 bits, see alignment E=2.9e-33 PF13692: Glyco_trans_1_4" amino acids 199 to 335 (137 residues), 91.2 bits, see alignment E=2.3e-29 PF13524: Glyco_trans_1_2" amino acids 276 to 356 (81 residues), 37.9 bits, see alignment E=4.9e-13

Best Hits

KEGG orthology group: None (inferred from 68% identity to azl:AZL_a06950)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ATC7 at UniProt or InterPro

Protein Sequence (402 amino acids)

>AZOBR_RS19360 glycosyltransferase family 1 (Azospirillum brasilense Sp245)
MGLIDRGFRRKKAPRACIVFATPGALDGGGGIGRMTGYIVDAFQNSPAAPETVVLDTRGT
GSALLSPVYLAGTLARLGALMLRRRPTVVHINVSENASVWRKAVVQLFAGLFSCPTVVHL
HGASFMEYFDKGPVSRAISRWLFDRCGIALVLGESWRNFLVQSVGTDPHKVRVLYNAVPD
IGADLPVRAAPPEGAIVSLLVLANLSERKGIGTLLRSCRLMKDRGFRFRVTIGGGGDVEG
YRRMAAELGVDGECRFEGWISREQAHAHLRDHDMLLLPSTHEGLPMVILEALSTGMPVIT
TPVGSIPEVLTDGETARIVPVNDPEALAHAVRDLAARPALYARLSAEGRRLFLEKFVIES
YGRSLQDIYAELNRPDAVRRPSLGALPDAAAAKPSLTRAGRQ