Protein Info for AZOBR_RS19255 in Azospirillum brasilense Sp245

Annotation: Rrf2 family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 TIGR00738: Rrf2 family protein" amino acids 1 to 133 (133 residues), 122.4 bits, see alignment E=5.8e-40 PF02082: Rrf2" amino acids 2 to 135 (134 residues), 130.2 bits, see alignment E=2.8e-42

Best Hits

KEGG orthology group: None (inferred from 86% identity to azl:AZL_c04130)

Predicted SEED Role

"Rrf2 family transcriptional regulator" in subsystem Flagellar motility or Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ATA4 at UniProt or InterPro

Protein Sequence (150 amino acids)

>AZOBR_RS19255 Rrf2 family transcriptional regulator (Azospirillum brasilense Sp245)
MLSQKAKYALRALIMLAERTDDELVLIAEIAERENIPRKFLEAILVELRKHGLLFAKRGK
SGGYRLARPAEEISFGEVIRLIDGHLAPIPCASKNSFRPCEDCIDPPTCSVRWLMVQVRD
ATAQVLDNQTLSDALRHRQATGGLPVNFDI