Protein Info for AZOBR_RS19065 in Azospirillum brasilense Sp245

Annotation: anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 PF00126: HTH_1" amino acids 24 to 81 (58 residues), 53.7 bits, see alignment 1.6e-18 PF02885: Glycos_trans_3N" amino acids 174 to 227 (54 residues), 63.5 bits, see alignment 1.2e-21

Best Hits

KEGG orthology group: None (inferred from 47% identity to atu:Atu3917)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AT64 at UniProt or InterPro

Protein Sequence (496 amino acids)

>AZOBR_RS19065 anthranilate phosphoribosyltransferase (Azospirillum brasilense Sp245)
VPEASAPGKAALGGQENRLSRGRLIVALDALLSKRNVTLAARDLGLQTSALSRLLAQMRE
EFGDPLFIRSGRGLVPTPFAEALRPRVQALARGIDALFEPSMERPAPDETFDPRWNVPTG
IDAPPLQVRPAGLLEGQPSPAQIDAKLDKIGPDASAQDRLARHIGVLGVAGGGHGRPLTA
EEAEEAMTIILEGEADPVQVGALLGMMRMRGSTAPELAGLVRAMRAHVAAGLGRTIQADI
DWPCFTSPNYHNPPWFFHAARLVAQAGHRVLLHGGTGCSAASGRYEFIAPTVGIPVCANA
REIAAALAAQRIAYAPLAALSPQIYRLIGLHRLTQTRSAVFEAVHLLKPAKAKTSLLGAA
KPTYRELHRDAARILGWKHMAVLGSVRDVAQFTPFRPSSIHRLVNGEAEDLILPACMEEP
PPTPRPRGTSLEYWQGVWTGAVRDARAERIIVGTAAFALFALPGATGPAFADALRLAEQL
WKARLGQGAMAVQSPP